PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_10020V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 483aa    MW: 53474.4 Da    PI: 5.428
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_10020V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv +++++G g+W+  +++ g+ R++k+c++rw +yl
  Pp3c16_10020V3.2.p 15 KGPWTPEEDQKLVAYIQEHGHGSWRELPEKAGLARCGKSCRLRWTNYL 62
                        79********************************************97 PP

2Myb_DNA-binding56.18.3e-1868113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rgr++ eEd++++++++ lG++ W++Ia +++  Rt++++k++w+++l
  Pp3c16_10020V3.2.p  68 RGRFSHEEDQKIIQLHAILGNR-WSAIAGHLP-QRTDNEIKNYWNTHL 113
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1291062IPR017930Myb domain
SuperFamilySSF466892.66E-3112109IPR009057Homeodomain-like
SMARTSM007173.7E-141464IPR001005SANT/Myb domain
PfamPF002491.6E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-251669IPR009057Homeodomain-like
CDDcd001673.77E-121762No hitNo description
PROSITE profilePS5129426.86863117IPR017930Myb domain
SMARTSM007171.6E-1667115IPR001005SANT/Myb domain
PfamPF002494.5E-1668113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2770117IPR009057Homeodomain-like
CDDcd001672.52E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MGRAPCCDER MSVKKGPWTP EEDQKLVAYI QEHGHGSWRE LPEKAGLARC GKSCRLRWTN  60
YLRPDIKRGR FSHEEDQKII QLHAILGNRW SAIAGHLPQR TDNEIKNYWN THLKKRLAQM  120
GIDPITHKTS SSGLALTSSW RPIVSTQLTH MTQWDCALAE AEARLSKKSS MKPFIRFPEA  180
AQSSAHPSTY FMRSWKTGIE DKHRPKFGIV KRESSPVRID CPSLVPNPAR RPSNLLQNWD  240
TILGLRTDQP GSLWQQPGAW SMSHTLKQIA TSGRSHHLDE SAASQARSST IDMSGEVASM  300
ADDMMFPQID RTGSNLLFVF ESAGATRSDS VDRYGTTTPG DYFSPTSTLH GPDPDFTHSE  360
SGSPCGSSTD GSTLDCFDFT VQPEGSFHSF SLLPNGDGDG DDGDARLQES SLYDIPDTFW  420
QAGQETEALQ LQTVEISDDG GPDSGGLDLI IPLDFSNAEF SQHLESLCQE PSEYQTDIGE  480
VL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001782292.11e-107predicted protein, partial
TrEMBLA9TUL31e-107A9TUL3_PHYPA; Predicted protein (Fragment)
STRINGPP1S106_216V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-85myb domain protein 16